PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf70695g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 188aa    MW: 21183.2 Da    PI: 6.4964
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf70695g00005.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.89.3e-12108149446
                               S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               W ++E+ ll+++++++G  +W+ +a+++g +++  qc++++++
  Peaxi162Scf70695g00005.1 108 WNADEEMLLLEGIEMYGLANWAEVAEHVG-TKSKMQCIDHYNS 149
                               *****************************.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002916.2E-104489IPR000433Zinc finger, ZZ-type
PfamPF005694.5E-114689IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013510.9364891IPR000433Zinc finger, ZZ-type
CDDcd023359.01E-234896No hitNo description
SuperFamilySSF578502.35E-1448111No hitNo description
PROSITE patternPS0135705077IPR000433Zinc finger, ZZ-type
SuperFamilySSF466891.72E-13100154IPR009057Homeodomain-like
PROSITE profilePS5129321.094103155IPR017884SANT domain
SMARTSM007172.7E-11104153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-9107150IPR009057Homeodomain-like
CDDcd001673.31E-13108150No hitNo description
PfamPF002491.0E-11108149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MGRSRAVHQP ADDDPSQRSK RKRIAQNVET FDTAAAGQIL SDGKKALYHC NYCNKDISGR  60
IRIKCVVCSD FDLCVECFSV GAEVHPHKSN HLYRVMDNLS FPLICADWNA DEEMLLLEGI  120
EMYGLANWAE VAEHVGTKSK MQCIDHYNSI YINSSCFPIP DMSHVMGKNK EELLAMAKEQ  180
GKLMSFAF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0146080.0BT014608.1 Lycopersicon esculentum clone 134091F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598897.11e-129PREDICTED: transcriptional adapter ADA2-like isoform X1
SwissprotQ75LL67e-91TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLK4CEW81e-110K4CEW8_SOLLC; Uncharacterized protein
STRINGSolyc07g047610.2.11e-110(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24471215